MVS Pacific logo

Antibodies


 

BACE-1 (Cat #: AA117)
Rabbit polyclonal antibody to BACE-1
BACE1 mouse brainImmunohistochemical detection of BACE-1 in astrocytes in rat cortex. Rat brain was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to BACE-1 at 10 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200 dilution. Nuclei were counterstained with DAPI (blue)

 

BACE1 WB

BACE1 rat cerebellumImmunohistochemical detection of BACE-1 in mouse cerebellum. Mouse brain was fixed with 4% formaldehyde and cut into 10 μm thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to BACE-1 at 10 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200 dilution. Nuclei were counterstained with DAPI (blue) BACE1 in Alzheimer's brainImmunohistochemical detection of BACE1 in reactive astrocytes in formalin fixed Alzheimer's human brain.12 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to MMP1 at 8 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). Function:
BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. BACE-1 is a member of the peptidase A1 protein family and is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. In brains of patients with Alzheimer's disease, BACE-1 is detected in reactive astrocytes, suggesting that astrocyte activation may play a role in the development of Alzheimer's disease.
Formulation Lyophilized powder
Purification Affinity purified
Host Species Rabbit
Unit Size: 50 µg
Immunogen Synthetic peptide
Sequence: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Alternative Names Aspartyl protease 2; Beta-site amyloid precursor protein cleaving enzyme 1; Memapsin-2; Membrane-associated aspartic protease 2
Accession Number: P56817
Gene Symbol BACE1
Accession URL: http://www.uniprot.org/uniprot/P56817
Applications: Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB).
Working Dilution for Immunofluorescence (ICC): 5 – 15 µg/mL
Working Dilution for Immunohistochemistry (IHC): 5 – 10 µg/mL
Working Dilution for Western Blottin (WB): 1 µg/mL
IHC Positive control: Human brain (neurons and glial cells).
Specificity: Confirmed by WB.
Cross-reactivity: Human; mouse; rat
Reconstitution: Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material.
Storage / Stability: At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
References
  1. Ahmed RR, Holler CJ, Webb RL, Li F, Beckett TL, Murphy MP. J Neurochem. 2010 Feb;112(4):1045-53. PMID: 19968762
  2. Mulder SD, van der Flier WM, Verheijen JH, Mulder C, Scheltens P, Blankenstein MA, Hack CE, Veerhuis R. J Alzheimers Dis. 2010;20(1):253-60. PMID: 20164582
  3. Hou Y, Bao XQ, Wei HL, Luo Y, Liu GT. Neurol Res. 2011 Jan;33(1):43-9. PMID: 20626958
  4. Boddapati S, Levites Y, Sierks MR. J Mol Biol. 2011 Jan 14;405(2):436-47. PMID: 21073877
  5. Rossner S, Lange-Dohna C, Zeitschel U, Perez-Polo JR. J Neurochem. 2005 Jan;92(2):226-34. Review. PMID: 15663471.

 

©2011 MVS Pacific, LLC All rights reserved