Antibodies
Rabbit polyclonal antibody to Synaptophysin | |
---|---|
![]() Nuclei of keratinocytes were counterstained with DAPI (blue) |
![]() |
Formulation | Lyophilized powder |
Purification | Affinity purified |
Host Species | Rabbit |
Unit Size: | 50 µg |
Immunogen | Synthetic peptide |
Sequence: | MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE |
Alternative Names | Major synaptic vesicle protein p38. |
Accession Number: | P08247 |
Gene Symbol | SYP |
Accession URL: | http://www.uniprot.org/uniprot/P08247 |
Function: Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells. |
|
Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
Working Dilution for Western Blottin (WB): | 1 µg/mL |
IHC Positive control: | Brain, spinal cord, neuroendocrine cells |
Specificity: | Confirmed by WB. |
Cross-reactivity: | Human; mouse; rat |
Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|