Antibodies
| Rabbit polyclonal antibody to TGF beta 1 | |
|---|---|
 Immunohistochemical detection of TGF beta 1 in distal convoluted tubules in mouse kidney cortex. Tissue was fixed with 4% formaldehyde and cut into 12 μm thick cryostat sections. Tissue sections were incubated with rabbit polyclonal antibody to TGF beta 1 at 8 μg/mL overnight at 4°C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200 dilution. Nuclei were counterstained with DAPI (blue). |
 |
 Immunohistochemical detection of TGF beta 1 in formalin fixed human prostate. 5 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to MMP2 at 8 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). |
Function: TGF beta 1 (TGFB1) is a protein performing many fiunctions including control of proliferation and differentiation, and regulates the actions of many other growth factors. It is a potent stimulator of osteoblastic bone formation. Inactive TGFB1 is a homodimer consisting of a TGFB1 which is non-covalently linked to a latency-associated peptide (LAP), and the active form of TGFB1 is a homodimer of mature TGFB1 protein. |
| Formulation | Lyophilized powder |
| Purification | Affinity purified |
| Host Species | Rabbit |
| Unit Size: | 50 µg |
| Immunogen | Synthetic peptide |
| Sequence: | DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS |
| Alternative Names | N/A |
| Accession Number: | P04202 |
| Gene Symbol | TGFB1 |
| Accession URL: | http://www.uniprot.org/uniprot/P04202 |
| Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): | 1 µg/mL |
| IHC Positive control: | Kidney (epithelial cells in convoluted tubules); stromal and epithelial cells in prostate. |
| Specificity: | Confirmed by WB. |
| Reactivity: | mouse, human |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|
|